PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676744902
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family SRS
Protein Properties Length: 407aa    MW: 42344.2 Da    PI: 8.8985
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676744902genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702138.18.2e-432223613154
     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkelet 102
                sgta+CqdCGnqakk+C+++RCRtCCksrgfdC+thvkstWv+aa+rrerq + ++  +  ++ ++++ +k++r    ++q+a+s+t++s++ ++++++t
  676744902 222 SGTATCQDCGNQAKKECKQRRCRTCCKSRGFDCSTHVKSTWVSAARRRERQVMPTTNPTAGSSLSTSSGTKKPRIV-GSQQQATSHTSTSNT-PPQSFDT 319
                7899**********************************************99999988888888899999999986.667777778877766.5666666 PP

     DUF702 103 sslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                ss           r    +s +    ++aYq++v+igGhvfkG+LydqGle 
  676744902 320 SSS----------RQDGGGSREAWPGQYAYQAVVKIGGHVFKGFLYDQGLEP 361
                632..........3344567788899***********************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.4E-40224360IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.5E-26226268IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016247.8E-14336359IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MCLQELTGAA GSLGNRSREW LQASGATRTS AGAVATTRRH NLPTSDSGAF TDWAATTTTS  60
SRATEDLSLG FNAGPAVVHG GLGSASAAAG VPSWHPGSSV RYGLPSSAAA TEMGMVGLRD  120
VYLVAPAYHQ HHHHQNAGVV SGSDQINSNA ALGVGVIPLL TAAPPQQQQN VEDTDINFLG  180
DSRRWQNNNS NNSQTQYLHF KSTQQTAVAS SSNNSGSGSA ASGTATCQDC GNQAKKECKQ  240
RRCRTCCKSR GFDCSTHVKS TWVSAARRRE RQVMPTTNPT AGSSLSTSSG TKKPRIVGSQ  300
QQATSHTSTS NTPPQSFDTS SSRQDGGGSR EAWPGQYAYQ AVVKIGGHVF KGFLYDQGLE  360
PKEGFPNMSD LHLGGGANNH NGVSASPPIL DPPNLYGGGG SGGGFYG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2052660.0GU205266.1 Brassica rapa subsp. pekinensis lateral root primordium 1 (LRP1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013727118.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like
SwissprotQ94CK91e-143LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A0D3AIQ60.0A0A0D3AIQ6_BRAOL; Uncharacterized protein
STRINGAT5G12330.40.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58832646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.41e-142Lateral root primordium (LRP) protein-related